PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma192g00160.1
Common NameZOSMA_192G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 447aa    MW: 51780.4 Da    PI: 8.8769
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma192g00160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.23.7e-152074256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +kR   ++ q+e+Le++++ ++yps+ ++   A+++gL+ +qV+ WF+ rRak+k
  Zosma192g00160.1 20 SKRIMKSPFQIEALEDFYQDHKYPSEPMKLVFANEIGLSLKQVSGWFCHRRAKDK 74
                      589999***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.5721676IPR001356Homeobox domain
SMARTSM003892.3E-131880IPR001356Homeobox domain
SuperFamilySSF466892.44E-141976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-152174IPR009057Homeodomain-like
PfamPF000461.0E-122174IPR001356Homeobox domain
CDDcd000864.83E-122174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MGMEDIKRED GSPSLIENNS KRIMKSPFQI EALEDFYQDH KYPSEPMKLV FANEIGLSLK  60
QVSGWFCHRR AKDKGLVSTD EGRAKHVPDA VHEYSTGVIQ ESCSSTKHDD FRHFEVKEVE  120
SKRLNAQNFA KQILPSEKKR RRLHPRHHQH HTSSIDDLTP QSSLESQEML LPVIEEPYGG  180
SEIRRNMHDE NVKRPSSTHL NRRMKKSSRI SHLSMKELRV FCVSSVKKKL GRFYDENGPS  240
LSIDFDPLPP GAFDSPIVDA VNEACHVRDF NYNMERFSNY PEPYSSYAKP KDHQRKIQGL  300
TRKKEMNNYP SKSRVILTDK LDQRQIHTSH TEIGDGFATE GVGFENNSEE KCNKKLDLHP  360
PLYIDQWAPI LQRRKLKKRT DSLDDEDDVN DKLREKDIPI LKKHKTDGGL DQKRLFEKET  420
RISERPREEL WKKNYILAMP CSSGST*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138142KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PP420.0A0A0K9PP42_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2549644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-37HB-other family protein